PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_70567.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family HSF
Protein Properties Length: 122aa    MW: 13377.1 Da    PI: 6.3808
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_70567.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind80.52.6e-2541103264
                   HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE CS
  HSF_DNA-bind   2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkk 64 
                   Fl+k+y++++d+ +++++sw e+  +fvv+ + efa+++Lp+yFkh+nf+SFvRQLn+Y  ++
  MLOC_70567.2  41 FLTKTYQLVDDPCTDHIVSWGEDDATFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYVCHS 103
                   9**********************************************************7665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.103.9E-2735103IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004153.6E-2537121IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467852.58E-2338112IPR011991Winged helix-turn-helix DNA-binding domain
PRINTSPR000566.4E-164164IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004471.7E-2141103IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000566.4E-167991IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000566.4E-1692104IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 122 aa     Download sequence    Send to blast
MAFLVERCGE MVVSMEMGSG AHGGGGGGGG GGVGKPVPAP FLTKTYQLVD DPCTDHIVSW  60
GEDDATFVVW RPPEFARDLL PNYFKHNNFS SFVRQLNTYV CHSSYSLSPA PYTTHERMHP  120
HM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5u_B8e-171799387Heat shock factor protein 1
5d5v_B8e-171799387Heat shock factor protein 1
5d5v_D8e-171799387Heat shock factor protein 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3768811e-166AK376881.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3143C10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006658884.14e-55PREDICTED: heat stress transcription factor B-4b-like
SwissprotQ7XHZ01e-53HFB4B_ORYSJ; Heat stress transcription factor B-4b
TrEMBLM0YLN32e-88M0YLN3_HORVD; Uncharacterized protein
STRINGMLOC_70567.12e-68(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46264.11e-40heat shock transcription factor B4